- MRPL10 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82858
- This antibody was developed against Recombinant Protein corresponding to amino acids: NVALSAEDKL LMRHQLRKHK ILMKVFPNQV LKPFLEDSKY QNLLPLFVGH NMLLVSEEPK VKEMVRILRT VPFLPLLGGC
- 0.1 ml (also 25ul)
- MRPL10
- Unconjugated
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- Human
- L10MT, MRP-L10, MRP-L8, MRPL8, RPML8
- PBS (pH 7.2) and 40% Glycerol
- mitochondrial ribosomal protein L10
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC
Specifications/Features
Available conjugates: Unconjugated